Protein Info for BBR_RS12600 in Bifidobacterium breve UCC2003

Annotation: serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 104 to 138 (35 residues), 30.1 bits, 1.4e-11

Best Hits

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 38% identity to pph:Ppha_1012)

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

• L-cysteine biosynthesis VI (reverse transsulfuration) (5/7 steps found)
• L-cysteine biosynthesis I (1/2 steps found)
• L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (2/4 steps found)
• seleno-amino acid biosynthesis (plants) (2/5 steps found)
• N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (4/9 steps found)
• D-cycloserine biosynthesis (1/6 steps found)
• superpathway of seleno-compound metabolism (4/19 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.30

Protein Sequence (154 amino acids)

>BBR_RS12600 serine acetyltransferase (Bifidobacterium breve UCC2003)
MNNPGVLPKVLVATIRFGMWTEHIRPRILGLPFRLLHRLVELLFCKLLLNCDISVKAEIG
QGLTIYHPYGIFVNSDAKIGRDFTCRAYTTIGNKGTYDERDGCPTIGDGVNVGVGAKIIG
PITVGSNCSIGANAVVTHSFADGNILVGIPAKAI