Protein Info for BBR_RS12550 in Bifidobacterium breve UCC2003

Annotation: sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 95 to 117 (23 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 99 to 571 (473 residues), 376 bits, see alignment E=1.7e-116 PF13727: CoA_binding_3" amino acids 152 to 262 (111 residues), 28 bits, see alignment E=2.2e-10 PF02397: Bac_transf" amino acids 379 to 567 (189 residues), 226.4 bits, see alignment E=1.9e-71

Best Hits

KEGG orthology group: None (inferred from 98% identity to blf:BLIF_0362)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>BBR_RS12550 sugar transferase (Bifidobacterium breve UCC2003)
MSRISTTASATAQHMSNTTAETETLHRVQISRAQAAHTDSHIADATPDTAAPTFFDGTYF
SSSPDGTVTHNDAGDRPHLTEYSVPKWRYLYNTTMVILDLLMTIIATCIVFACNPRAYAN
VQTMGPADYGVLSFLSLACVSWLISLYAARSYERHTMGEGYGLYAKLLNAAFIDFIMLCT
LGYLFHLNVPRSLNVFIPILSLILIIVERWLMRRALHRNRAKGEFNYPTIIIGSPEGIRE
TLKQLKACLSLGYAPIAVCPVAPVCDSDDPNAAQHLVPVPFIPTNDEEARLKVLALNSHL
PQTAKRMKVRTILIADVLTRDSETMRTLSLAVESMGIELALTASVADLSGANLQLHNDPS
MPILTARLAQYSLPTRIFKRVCDIVLSLVAIILSSPIMLWAAYKVKREDGGPVFYSQTRI
GIYGKPFTMYKFRSMRLNADKMDAEVAAAAGVELGTTFKVKDDPRVTKIGKFIRKTSIDE
VPQFFNVLKGDMSMVGPRPQRQYEVDQYSPLYSTRLLVKPGITGPWQISGRNDLSQEQSE
YADVSYIQNWSITGDIAILLKTVGAVFNGTGM