Protein Info for BBR_RS12535 in Bifidobacterium breve UCC2003

Annotation: divalent metal cation transporter MntH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 416 to 438 (23 residues), see Phobius details PF01566: Nramp" amino acids 64 to 410 (347 residues), 366.2 bits, see alignment E=9.2e-114

Best Hits

Swiss-Prot: 55% identical to MNTH_MYCTO: Divalent metal cation transporter MntH (mntH) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03322, manganese transport protein (inferred from 90% identity to blb:BBMN68_1014)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>BBR_RS12535 divalent metal cation transporter MntH (Bifidobacterium breve UCC2003)
MTAPHTAASATAADIEQETSEIEKERRIASDEANNKENPHGHALASILGPAFVAAVAYVD
PGNVAANITSGARYGYLLVWVLVLANAMSVLIQYQSAKLGIVTNKSLPELLGERMSDAGR
FMFFMQAEVIAIATDLAEVIGGAIALNLLFGLPMFLGGLVIGAVSTVMLWFQGGKSQTTF
ERIIIVMLLVITFGFIAGLFVAPPNPVEVAKGLIPRFKGTDSVLMAASILGATVMPHAIY
LHSTLVNDHYAGGEKPSVERQLKGSKIDVAWALLLAGTVNLAMLVLAANSLHGMSGTDSI
DGAQRAIAQVLGPVIGMIFSIGLLASSLSSTSVGTYAGSEIMHGLLHVNAPMWACRVVTL
VPALIVLWFAKDPTEALVIGQVVLSIGIPFAVIPLMRYTHSKELMGKWADGTIKHIIFLI
VVALIVTLNVLLIVLTLMGRA