Protein Info for BBR_RS12500 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 37 to 61 (25 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 126 to 301 (176 residues), 49 bits, see alignment E=3.1e-17

Best Hits

KEGG orthology group: None (inferred from 90% identity to bll:BLJ_0415)

Predicted SEED Role

"ABC-type sugar transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>BBR_RS12500 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MAAASQPTVGILPEEADLHTAEARVNKHKADWRGWKFMWPFTVVFVFVFIIPIVYAVYIS
FFKKQMIGGTRFVGVENYARLLQDGQFWSSVGRVALFTCVQVPIMLFLSAAMALALDSMK
LHGAKFFRISTFLPYAVPAVVSTLVWGFVYGAKYGLVGSFNDFFGTNVDVLQPGVLLASI
GNISTWEFTGYNMLIFYSSLSTIPHSLYEAASIDGASEWQIVKSIKLPELKGSLAITVIF
SIIGSFQLFNEPSILQNMVPGNAITTYYTPNMYAYNLSFSGNQSNYAAALAIVMAVITMA
IAYAVQLKSMKEQMK