Protein Info for BBR_RS12455 in Bifidobacterium breve UCC2003

Annotation: ribonuclease HII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF01351: RNase_HII" amino acids 207 to 283 (77 residues), 54.8 bits, see alignment E=6e-19

Best Hits

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>BBR_RS12455 ribonuclease HII (Bifidobacterium breve UCC2003)
MITPTLDLERSLASQDYDLIVGFDEVGRGALAGPVMVGCAAIWARDLKPDADGELAQADG
SAASSRVSGDNGTDAGVITPDPAPYLSVPAGVADSKMLTEHRREAIFDELCSWCAAYAVG
QASNAEIDEWGITYALGVAALRALNQVERDLGVGSEFGSPREGSCLTATEGKPLPSRRPI
TIGAILDGPSDYITKALNTFDAPDVPIPADVTTKVKGDQHCATVATAAVIAKVTRDRLMV
SIAQGNPRYAAYEWDHNKGYGSAAHRAAIAEYGPTPLHRTSWHLT