Protein Info for BBR_RS12450 in Bifidobacterium breve UCC2003

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 112 to 134 (23 residues), see Phobius details PF10502: Peptidase_S26" amino acids 111 to 280 (170 residues), 131.3 bits, see alignment E=1.7e-42 TIGR02227: signal peptidase I" amino acids 115 to 283 (169 residues), 123.3 bits, see alignment E=4.3e-40

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 70% identity to bln:Blon_0421)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>BBR_RS12450 signal peptidase I (Bifidobacterium breve UCC2003)
MQDDQDNGESPALDTLEIWNGSSTAESATDEPLATRSAAYDFSGDDPADSGAYQPPLDDD
ARDSRTFQVADHGVALSPVPPAPIRSSRSSRAKHADSAAARTGDDRFTLRDFAIWCGTPI
LIVLLVRIFLVGFYEIPSRSMMDTFVPGDRVMTSKIFNLQRGDVVVFKDPNNWLNEERSN
AIGGGFLIKRLIGMPGDVVECKGAGQPITINGVEIDESSYIRPGVEPSAFPFSVTVTEGH
VFVMGDNRSNSADSRYHQNDNDHGLVPIDDVVGTGLAIYWPINHIGLLASHHDVFKDVPD
ASSGSAS