Protein Info for BBR_RS12440 in Bifidobacterium breve UCC2003

Annotation: Permease of ABC transporter system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 118 to 143 (26 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details amino acids 429 to 450 (22 residues), see Phobius details amino acids 457 to 481 (25 residues), see Phobius details amino acids 505 to 526 (22 residues), see Phobius details amino acids 563 to 582 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 275 (172 residues), 51.2 bits, see alignment E=6.8e-18 amino acids 410 to 580 (171 residues), 69.5 bits, see alignment E=1.6e-23

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 90% identity to bll:BLJ_0396)

Predicted SEED Role

"ABC-type anion transport system, duplicated permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>BBR_RS12440 Permease of ABC transporter system (Bifidobacterium breve UCC2003)
MTMFSFNHAAMRPSSPARNPSTSSADRQPFTVRLAADALVIAGILALFGLIAWILPAIGE
PIGPKGVPSSVSTNLADLPYYALRSVFRMFVALFFSLVFTFVYGTAAARCRRLSRVLIPL
LDILQSVPILGFLSATITIWMVLFPGSMLGVEAASIFAIFTSQAWNMAFSFTRSLTSEPR
ELDEAARSLRLTRWQRFWTLDVPNAMIPLLWNCMMSVGGGWFFLTASEMISVNNHTYALP
GIGSFVAQAAAEENLAAICWAIVTMVAVVLLIDVLLWKPLTAWAEKFRITQSESAVRKTS
AVLTIIRQSHIDEMLDRLFQPVGELFDTLTRPLGRTGGRWPVETKSTRSRVLDVLFMVVV
VTASAFGVIELMLVIHRDAGFDELGHALALGMLTFLRVALLTIVCSVIWVPVGALIGMNP
RVSRFMQPIVQVLASFPSNFTFPFVTLWFVACSVNINWGSILLMALGTQWYILFNVIAGA
SQIPDDLREMAHSFQLGRWQRWRELILPAVFGSWVTGGITAAGGAWNASIVSEIVSYGQH
TLTASGLGAYIAEATENGDTVRTIIGVAVMSVFVVAVNRLFWNPLQRLAERRFALN