Protein Info for BBR_RS12400 in Bifidobacterium breve UCC2003

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR01513: nicotinate phosphoribosyltransferase" amino acids 7 to 372 (366 residues), 417 bits, see alignment E=5.1e-129 PF17767: NAPRTase_N" amino acids 8 to 132 (125 residues), 115 bits, see alignment E=4.1e-37 PF01729: QRPTase_C" amino acids 137 to 306 (170 residues), 24.8 bits, see alignment E=2.5e-09 PF04095: NAPRTase" amino acids 153 to 337 (185 residues), 32.6 bits, see alignment E=1e-11

Best Hits

Swiss-Prot: 56% identical to PNCB1_MYCTU: Nicotinate phosphoribosyltransferase pncB1 (pncB1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 94% identity to bll:BLJ_0383)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>BBR_RS12400 nicotinate phosphoribosyltransferase (Bifidobacterium breve UCC2003)
MVDYSPALMTDMYEYTMLDAALKDGTANRKCVFEVFTRHLPEGRRYGVVAGTGRILDALE
HFHLDDEDLKFLSDRHVVSPETIKWLENFHFTGSIKGYREGEMFFPNSPILQVEGTFGEC
TLLETLILSVLNYDSAVASAASRMVSAAKDRPCMDMGGRRTNEWAAVAAARAAVVGGFKG
TANLLAAQLYGLKAIGTAAHCFTLVHDSERDAFESQIEALGKNTTLLVDTYNIEEAVKTA
VEVAGPELGGVRIDSGDLAAMAQRVRNQLDALGATNTTITVTNDLDEYALAALQTAPVDS
YGVGTMLVTGSGAPTCAMVYKLTEREGADGTMVPVMKKSKDKATVPGRKLAFRSYEYSLA
ETEHVISGSEEKLAGYVADPAWKNLLVDFVNHGQIDGQWQGHDAIVAAHEYHATALGELP
IAAQSLMKGEPVIPTETTVL