Protein Info for BBR_RS12375 in Bifidobacterium breve UCC2003

Annotation: pantetheine-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01510: pantetheine-phosphate adenylyltransferase
  • amino acids 3 to 156 (154 residues), 170.7 bits, E=2.3e-54
• TIGR00125: cytidyltransferase-like domain
  • amino acids 3 to 58 (56 residues), 59.1 bits, E=3.7e-20
• PF01467: CTP_transf_like
  • amino acids 5 to 133 (129 residues), 75.5 bits, E=2.4e-25

Best Hits

Swiss-Prot: 93% identical to COAD_BIFLD: Phosphopantetheine adenylyltransferase (coaD) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 93% identity to bln:Blon_0404)

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis III (mammals) (3/5 steps found)
• coenzyme A biosynthesis I (bacteria) (2/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (2/4 steps found)
• coenzyme A biosynthesis III (archaea) (1/4 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (4/9 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Protein Sequence (166 amino acids)

>BBR_RS12375 pantetheine-phosphate adenylyltransferase (Bifidobacterium breve UCC2003)
MTIAVCPGSYDPVTAGHLDVIERSARFFDEVHVVVAVNAAKTPMFSESTRVEVIRRALEK
AGCTNVVVSSTDGLITDYCQKVGATVIVKGLRQNGDYEAELGMALVNRKLAGIETLFLPA
DPILEHISSSIVKDVARHGGDVTGMVPDCVVPMLSDALAQEREAKD