Protein Info for BBR_RS12355 in Bifidobacterium breve UCC2003

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR02191: ribonuclease III" amino acids 29 to 238 (210 residues), 219.1 bits, see alignment E=2.6e-69 PF14622: Ribonucleas_3_3" amino acids 31 to 156 (126 residues), 125.7 bits, see alignment E=2e-40 PF00636: Ribonuclease_3" amino acids 53 to 144 (92 residues), 84 bits, see alignment E=1.8e-27 PF00035: dsrm" amino acids 172 to 238 (67 residues), 42.2 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 92% identical to RNC_BIFLO: Ribonuclease 3 (rnc) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 92% identity to bll:BLJ_0375)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>BBR_RS12355 ribonuclease III (Bifidobacterium breve UCC2003)
MSEKTTQQETADRQAPANELLEALGTTISPDLLVQALTHRSFSHEHPGVSNYERLEFLGD
AVLELVTTETLFTIHPDMNEGQLAKMRAKAVSEDALSAIAKTKLKVGPYILLGHGEAEQG
GAEKNSILCDIVESLIGATFLEHGIDEARKVIHRLIDDTLAEVATEGPALDWKTSLTVKA
HHLGKAEPVYHMEVSGPEYAQIFTAKVTLGDNPEIIGTGKGSSKRKAQLAAAEAGWKALD
ALKTRTK