Protein Info for BBR_RS12345 in Bifidobacterium breve UCC2003

Annotation: acetolactate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 14 to 170 (157 residues), 195.8 bits, E=2.2e-62
• PF01842: ACT
  • amino acids 15 to 80 (66 residues), 63.1 bits, E=3.2e-21
• PF13291: ACT_4
  • amino acids 16 to 85 (70 residues), 27.1 bits, E=1.1e-09
• PF13710: ACT_5
  • amino acids 23 to 85 (63 residues), 50 bits, E=4.3e-17
• PF10369: ALS_ss_C
  • amino acids 96 to 169 (74 residues), 102.2 bits, E=2.8e-33

Best Hits

Swiss-Prot: 58% identical to ILVH_MYCS2: Acetolactate synthase small subunit (ilvH) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 97% identity to bln:Blon_0398)

MetaCyc: 46% identical to acetohydroxy-acid synthase small subunit (Methanococcus aeolicus)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to (R)-acetoin II (2/2 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• L-isoleucine biosynthesis II (6/8 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Protein Sequence (185 amino acids)

>BBR_RS12345 acetolactate synthase small subunit (Bifidobacterium breve UCC2003)
MATNYPASRPGSERHTLSVLVENRPGVLARIAGLFARRAFNINSLSVSPTERPDISRVTV
TADVEAVPLEQIIKQLNKLLHVLKIVELDPNSTVERELVLIKVAADQSNRSDVLEIVRLF
RVRVVDVNPESLTIEATGAEGKIDALLGLLEHYGVIELVRSGAVAVTRGPHALSEKVVGS
EVTGR