Protein Info for BBR_RS12335 in Bifidobacterium breve UCC2003

Annotation: PIN domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF01850: PIN" amino acids 2 to 125 (124 residues), 57.9 bits, see alignment E=8.2e-20

Best Hits

Swiss-Prot: 44% identical to Y4JK_SINFN: VapC ribonuclease Y4jK (NGR_a03040) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07062, (no description) (inferred from 88% identity to bln:Blon_0396)

Predicted SEED Role

"VapC toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>BBR_RS12335 PIN domain-containing protein (Bifidobacterium breve UCC2003)
MIILDTNVISEIIKKQPDEHVANWLRNQDTSNLATTAITVAELLAGICQMPEGKRRKYTD
TTIKLELMTLADRTFAFDTQAAANYATIFIERERRGKPTSIQDAMIAAIARSWGASVATR
NTKDFEGTGVEFINPWEYKG