Protein Info for BBR_RS12315 in Bifidobacterium breve UCC2003

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 12 to 220 (209 residues), 112.9 bits, see alignment E=8.4e-37

Best Hits

KEGG orthology group: None (inferred from 94% identity to bln:Blon_0392)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>BBR_RS12315 cation transporter (Bifidobacterium breve UCC2003)
MPAQKLLERKALIVGIVVNVLQVFAGMAVFFMTGLKAMFLDFSFTAISVLSGLVAVYLST
RTVRTTERFPNGLFALEPIYAICKAIFTMSLLVYSLIDVCRVAYDYFVFGSGERIETGPV
VIYEILTVIVCFSLYMYYRRSNRAIGNSSTMLTAECKSTLVDGSMSFGIGVVAVFLMLLP
AGGPLDFLHYTGDFFITVALVVLTIREPFSVLKEAFVELVGGVHDDDETNAYVEAEAQRH
LPANTEYEQTLIFKTGMNYTVDVYLAGTGETIDVSDLIERKRSLEKELAKRLHLVDVDFV
FD