Protein Info for BBR_RS12310 in Bifidobacterium breve UCC2003

Annotation: signal recognition particle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 TIGR00959: signal recognition particle protein" amino acids 4 to 445 (442 residues), 578.4 bits, see alignment E=4.4e-178 PF02881: SRP54_N" amino acids 7 to 84 (78 residues), 75.4 bits, see alignment E=5.1e-25 PF00448: SRP54" amino acids 103 to 313 (211 residues), 220.9 bits, see alignment E=1.9e-69 PF02978: SRP_SPB" amino acids 346 to 443 (98 residues), 118.3 bits, see alignment E=2.5e-38

Best Hits

Swiss-Prot: 62% identical to SRP54_MYCTO: Signal recognition particle protein (ffh) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 98% identity to blo:BL0303)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>BBR_RS12310 signal recognition particle protein (Bifidobacterium breve UCC2003)
MAAFSSLTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADVALDVVRSFTGKVRER
ALGTEVSEALNPAQQVVKIVNEELTDVLGQGVDRPLNFAKNPPTIIMLAGLQGAGKTTLA
GKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYAPEKGVQSDGGEAVAAPG
QTSGDPVKVARDSIEIAKQKLYDTVIIDTAGRLGVDEELMKQARDIRDAVQPNEILFVID
AMIGQDAVKTAKAFDEGVDFTGVVLSKLDGDARGGAALSVASVTGKPILFASTGEGLKDF
EVFHPDRMASRILDMGDIMTLIEQAQKQFDEEKARKAAEKISEGSFGLDDFLDQLQQVRK
LGSMKSLLGMIPGMAQHRKELEQFDEKEIDRTEAIIRSMTPAERRDPSIINGSRRARIAY
GSGVTVSQVNALLQRFEQAAKMMKRMSNRGGMGGGMPGFGGPAMGGGKKKGKNKKKGGKS
GNPMKREAEEKALRDKLAGKKSSGSTGGSAFAKKPQNPALPAGLEEMMGNVDGGTELPPN
LGGGLSGLFGR