Protein Info for BBR_RS12265 in Bifidobacterium breve UCC2003

Annotation: DUF2207 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 317 to 339 (23 residues), see Phobius details amino acids 523 to 540 (18 residues), see Phobius details amino acids 546 to 569 (24 residues), see Phobius details PF09972: DUF2207" amino acids 44 to 274 (231 residues), 101.1 bits, see alignment E=8.9e-33 PF20990: DUF2207_C" amino acids 350 to 628 (279 residues), 138.7 bits, see alignment E=2.8e-44

Best Hits

KEGG orthology group: None (inferred from 73% identity to blj:BLD_1067)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (751 amino acids)

>BBR_RS12265 DUF2207 domain-containing protein (Bifidobacterium breve UCC2003)
MKKRFIRAGVISALITFAVACFAALMMVIMPAGDSADLSYRTLDYDVTATADGNLKVTQR
IDVKLRDRSDDDGDRPWKQLFQQYSLAPGNLTDITDISVRNVTDGIDYAQQTEPKLPSAV
SSNEAWNSDYANHWYIADVSASSDNPQPYTPGTDGIQVGESSKSAKTVEIGWNIPVTTEA
NSMKFEVSFTMHNVATKWQDVASFQWEPFGKKNQVPIGTVTGTVHFPEGITGKTSWAWLH
TERTSATKRESDGSYTFTAYNIRTGDYLDVVAAFDSSKAGDMARTQPGDHLNDLKTSEYN
QQQRWLDRQRLAARIRLIGWIATIVIGLALCIWGVWAAIASNRRAQYHGDIEYWRDQPGI
SPASAARLIKVVDLSVTGDSSDRELTATMLSLAVKKAIAIYPGPADMYRGIDMSQATPVG
LIQMITADPGKMNAARNTSTIVILPASLDAASNIEQLGLSQSEEALLALLITISQRVGCP
VFDLNQMKNVCKDWASGYLELNKFTDSCAAEYSPLTSTASSQWAVAGVLAVVLGLGALIV
NGTTGFMVAGMITGSPLLLVGLFCLLGGTSTALTEPGHEMAGRCLGLKRYMQDFSNFADR
GAADIAMWDWYMVYAAAFGISERVMKELAKAYPQVNDPAWLDANAAGTLFYWNYRPYGWY
GGRYYGDSATADQGNLGAAGPVPAYGGTSFAGGFSDLGSQLSAGFADISSTIQAAAPSSD
SGGDFGSFGSGGGSGFGGSFGGSGGGSFGGR