Protein Info for BBR_RS12250 in Bifidobacterium breve UCC2003

Annotation: ATP-binding protein of ABC transporter system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00005: ABC_tran" amino acids 42 to 185 (144 residues), 121.1 bits, see alignment E=5.5e-39

Best Hits

Swiss-Prot: 40% identical to YCLH_BACSU: Uncharacterized ABC transporter ATP-binding protein YclH (yclH) from Bacillus subtilis (strain 168)

KEGG orthology group: K02003, (no description) (inferred from 73% identity to bde:BDP_1302)

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>BBR_RS12250 ATP-binding protein of ABC transporter system (Bifidobacterium breve UCC2003)
MNTAIETNTATIVEPTTEPALQLEHVSYSYSKGGKRVLIDKNYDFRAGSVVSITGPSGAG
KTTLLSLLSGLTTPTKGRVLHNGEDLAKADRYRFRSHGIGVIFQSFNLLPALTVAENIIL
SVDASGKTFDRPKKQIATELIEKVRLQPEYLNERILHLSDGEQQRVSIARALSYNPQIIL
ADEPTGNLDLATQDDIMGIFKDLAHAEGKCVIIVTHSPEVAAQSDEVFQLAPLRER