Protein Info for BBR_RS12220 in Bifidobacterium breve UCC2003

Annotation: isopeptide-forming domain-containing fimbrial protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 481 to 503 (23 residues), see Phobius details TIGR04226: fimbrial isopeptide formation D2 domain" amino acids 219 to 340 (122 residues), 55.7 bits, see alignment E=8.9e-19 PF16569: GramPos_pilinBB" amino acids 233 to 346 (114 residues), 45 bits, see alignment E=2.8e-15 PF17802: SpaA" amino acids 369 to 438 (70 residues), 48.5 bits, see alignment E=1.1e-16 PF00746: Gram_pos_anchor" amino acids 470 to 507 (38 residues), 22 bits, see alignment 1.9e-08 TIGR01167: LPXTG cell wall anchor domain" amino acids 476 to 507 (32 residues), 15.9 bits, see alignment (E = 1.6e-06)

Best Hits

KEGG orthology group: None (inferred from 99% identity to bll:BLJ_1801)

Predicted SEED Role

"possible cell surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>BBR_RS12220 isopeptide-forming domain-containing fimbrial protein (Bifidobacterium breve UCC2003)
MKLRKLFAGVAAAATLLGGMAFGATAANAADTASITLSGKTVKGTVYTAYKIGSYDTASA
KVEKDKLASVGVTTDQAWKTDAENVLGSTVTNTPEYKGYGDPLAYVAGTTGYYTNTPATL
PNASATMESFVQSLAGKLDGKTAVDPSQTVANDNDKVVFSGLDEGLYLIVSKTDTEPATD
AGSPLAIVGTQVTVNGTAYTKLGANNQTLGKAVVKPSTPQKPSKSASDLNPYVGATITYT
LEGTVPAKANSFKFVDTPSAGLTVKLDTLKVNVQGETDPLANTEYTVDPASGDFNTSAAK
PSFTIALNNATKYQGKHIVVKCNALVNKKANVNGTNNDVRFDNSNQTTTTTITPQLNTVT
FTKKGVDADTNALKGVVFQIVADTNNATPLPDGTATEATSGDKGVVTFSGLPNGTYTITE
KTPADGYLTTALPSFTVTVENGKVTNVTPTGVGAGLVTFENGYANIVVKNVKKITQLPLT
GAAGTMLFTVVAVLLAGVAATVFAKSRFTKRALDA