Protein Info for BBR_RS12145 in Bifidobacterium breve UCC2003

Annotation: DUF4976 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF00884: Sulfatase" amino acids 16 to 356 (341 residues), 139.3 bits, see alignment E=2.7e-44 PF01663: Phosphodiest" amino acids 19 to 297 (279 residues), 35.8 bits, see alignment E=1.1e-12 PF16347: SGSH_C" amino acids 316 to 446 (131 residues), 54.9 bits, see alignment E=1.9e-18

Best Hits

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>BBR_RS12145 DUF4976 domain-containing protein (Bifidobacterium breve UCC2003)
MTHDSRSDTETGTSRPNFLVVMTDDQGPWALTRTMPELVTPTVDELVKTGTIFDNFYCAS
PVCSPARASLLTGRMPSAHGVHDWLIPGEEQPDPHEEEYLGGLLTLPEVLHEAGYVCAMS
GKWHVGTSRRPAPGFDFWYAHRKGGGPYFDAPIWDDHGNKRDEPRYFTDAVADEACRFLD
DYASGNVAGRTTSNSPFYMQVNFTAPHHPWVGSHPQELCDLYSGCDFASVPREPPHPWSK
PRTEFYEAFDDPVPQLRGYAASLSGVDRALRLLLDKLDEHDLASDTVIVYMADNGFSCGH
HGIWGKGNGTYPLNFWENSVRVPFIIRLPGQTEAHEVSDHVSATGFMSTICELAGVDPAD
DPLRAGSSFANLARSGVDDAKRESVMVFDEYGGGRMVRSGDYKLIERYDGPGELYHLGND
PEERENLYGTATHAHMQNELHDRLREWFAHHETAADSAWAHDVQGWGQLVPLRRGYDDKH
MYVHGLHLR