Protein Info for BBR_RS12135 in Bifidobacterium breve UCC2003

Annotation: anaerobic sulfatase maturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03942: anaerobic sulfatase maturase" amino acids 14 to 402 (389 residues), 436.9 bits, see alignment E=5.8e-135 PF04055: Radical_SAM" amino acids 20 to 176 (157 residues), 66 bits, see alignment E=7.2e-22 PF13353: Fer4_12" amino acids 22 to 131 (110 residues), 22.7 bits, see alignment E=1.7e-08 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 295 to 384 (90 residues), 63.4 bits, see alignment E=2.1e-21 PF13186: SPASM" amino acids 296 to 356 (61 residues), 35.5 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K06871, (no description) (inferred from 57% identity to ahe:Arch_1490)

Predicted SEED Role

"Putative arylsulfatase regulatory protein" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>BBR_RS12135 anaerobic sulfatase maturase (Bifidobacterium breve UCC2003)
MNDTMRRPRLPFTVIAKPTGAACNLDCQYCFFLSKELLYDSARQMMSEEVLESYIRQFLA
ASPDGEVTMLWQGGEPTLRGIDFFRTAVSLCERYRRKKQLVKHALQTNGTLIDDEWVAFL
REHDVLVGVSIDGPQDCHDAYRLNRGGKGTHAMAVRGWRLLHDAGVRCNILCTVHHANET
RGSEVYRYFRDELGADFMQFIPIVERVDSSQLERVERNGWRITGTRGERAGLLYRQTGEQ
VTSRSTSSKAYGRFLCDVFDEWIAHDVGRVFVQDFDGALGSLFGQYAVCVHAPECGYNFA
LEFNGDVYACDHWVEPDWLIGNVANADFFTLSQSARMQRFGLKKHAELTDQCRRCPYVRM
CNGGCPKDRFLKSKDGQNGQNYLCAGYSLFYEHIRPDIIGMARLIRSGHAASEIMDPRIR
SRVRVGGALP