Protein Info for BBR_RS12085 in Bifidobacterium breve UCC2003

Annotation: D-alanine--D-alanine ligase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR01205: D-alanine--D-alanine ligase" amino acids 5 to 392 (388 residues), 305.2 bits, see alignment E=2.3e-95 PF01820: Dala_Dala_lig_N" amino acids 5 to 157 (153 residues), 112.5 bits, see alignment E=4.6e-36 PF02786: CPSase_L_D2" amino acids 167 to 274 (108 residues), 22.4 bits, see alignment E=1.9e-08 PF07478: Dala_Dala_lig_C" amino acids 175 to 391 (217 residues), 204.7 bits, see alignment E=2.9e-64 PF02222: ATP-grasp" amino acids 203 to 360 (158 residues), 28.9 bits, see alignment E=2.1e-10

Best Hits

Swiss-Prot: 92% identical to DDL_BIFLO: D-alanine--D-alanine ligase (ddl) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 92% identity to bll:BLJ_0287)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>BBR_RS12085 D-alanine--D-alanine ligase A (Bifidobacterium breve UCC2003)
MAKKRIVVLYGGRADEHSISCISTAGVLAAMDTERFEPIPVGITKDGKWIIDGEDPRGWN
LDGDELPTVKITLKSRPVILDPSRGKDGFFAGEPDHLSNADSGFGTSFVSLSDPEIHHVL
TSLGHVDAVLPVLHGPYGEDGTVQGLLEMMGVPYVGCGVFASAACMDKHYTKVVLNAAGI
PTAPGIMVDARAFTAADVVAQIEAAGLAYPLFVKPSRAGSSFGVTKVDKAEDLETQQDRV
AAAIATAGEHDWKVLIEQGIDGREIECAVLCPKAGDEPEASWPGEIVLDHQNDDQFYDFD
SKYMDASASHVEVPANLPVSVLEDVRDVARRAFKAVDGAGLSRVDTFVTPDGTVMVNEIN
TMPGFTPISMYPKAWDATGVGYTELITRLIEGVLK