Protein Info for BBR_RS12040 in Bifidobacterium breve UCC2003

Annotation: peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00254: FKBP_C" amino acids 222 to 313 (92 residues), 79.9 bits, see alignment E=7.3e-27

Best Hits

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 83% identity to bln:Blon_0312)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>BBR_RS12040 peptidyl-prolyl cis-trans isomerase (Bifidobacterium breve UCC2003)
MRTLSTLTKTIAVACSLIMCISLAGCSNSSDSKSNSSKSSSSKTANQIAGVTAKGKLGEK
PTISFKAPMTVSDGSYVVLQKGDGDTIEEGDRVCAQGIALNVKDGTELMDTWTKNTPDCS
LLVDSSTLSSTYYDQIKGAKLNTTIGFGVNAEDSSGYSYILAMTFVSKSKDLKKATGEEV
KDVPSNLPKVTRAKNGKPSIDMNGQGAVDSLVSQTLVKGTGKEVTDKNTVVVKYTGWLTD
GTQFDSSWDKNTTLEADMYSGGQHGVIEGWQKGLIGQTVGSQVLLVVPPDQAYGDKKQGS
IPANSTLVFVVDILAAY