Protein Info for BBR_RS11870 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 114 to 320 (207 residues), 46.4 bits, see alignment E=2e-16

Best Hits

Swiss-Prot: 38% identical to YTEP_BACSU: Uncharacterized multiple-sugar transport system permease YteP (yteP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 69% identity to gym:GYMC10_0226)

Predicted SEED Role

"FIG00628646: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>BBR_RS11870 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MGAAEKSRRISTRRGRARSEGNVHRVRSWFVQFGRQWQLQAMILPGIIFMIVFNFIPIYG
LVLAFKQYTVVDTIEDAPWVGWQNFETILKDQYFWQSVVNTLGISFIKLTLGFLLPIVLA
VMIYEIPWTPFKKIVQTLTYLPHFFSWIILGGMLINWLSTNGLLNEILQFLGFNADSNYL
LDADKYWWIASLSDVWKEAGWGTILYLATMAGIDNALYEAAEIDGASKIQRIWNITIPGI
RQIIILNLILTVSGLLGSNLDQTLVLMNSQNQPKAEVINSYVYRVGLSEGDFSYATAVGL
GVSIVSTILLVAVNLVTKKINDNQSVL