Protein Info for BBR_RS11805 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details PF02659: Mntp" amino acids 34 to 183 (150 residues), 157.9 bits, see alignment E=8.4e-51

Best Hits

Swiss-Prot: 100% identical to MNTP_BIFLS: Putative manganese efflux pump MntP (mntP) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: None (inferred from 100% identity to bln:Blon_0280)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>BBR_RS11805 hypothetical protein (Bifidobacterium breve UCC2003)
MIAIIVQTLLISVSVAMDAFAVSIGKGLTVSRVRPGDAVRSALWFGGSQALFLILGHYAA
SAFSAYVTAFDHWIIFGLLAFIGGNMVHEAYEEDAENAKETAQFDWKHMLPLAVACSIDA
FAVGVSLAFMATSVPFAILCISVVTGLFSAAGLYIGRAFGAHWQKPAQIAGGVVLILIGV
KVLLEHLGIIAF