Protein Info for BBR_RS11790 in Bifidobacterium breve UCC2003

Annotation: endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01083: endonuclease III
  • amino acids 12 to 205 (194 residues), 232.9 bits, E=1.2e-73
• PF00730: HhH-GPD
  • amino acids 40 to 162 (123 residues), 84.7 bits, E=5.4e-28
• PF00633: HHH
  • amino acids 105 to 132 (28 residues), 39.3 bits, see alignment (E = 3.5e-14)

Best Hits

Swiss-Prot: 53% identical to END3_MYCTO: Endonuclease III (nth) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 87% identity to blf:BLIF_0224)

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Protein Sequence (222 amino acids)

>BBR_RS11790 endonuclease III (Bifidobacterium breve UCC2003)
MRETKTARIERMHKEYDILCRMIPQPQCALHFTSPLQLLIATVLSAQTTDKRVNTVTPEL
FATYPTAHDLAEANPAQVEDIIHPLGFYRSKTQHLIGLATALDERFDGQIPQSMDELTSL
PGVGRKTANVVLGNAFGIPGFPVDTHVMRVTGRLRWRSDWRSTHLDPVKIEREITACFPP
EEWTDLSHRLILFGRSTCHARTPDCANCPLAATCPSAGISAK