Protein Info for BBR_RS11770 in Bifidobacterium breve UCC2003

Annotation: chorismate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01795: chorismate mutase
  • amino acids 28 to 120 (93 residues), 162.6 bits, E=1.4e-52
• PF01817: CM_2
  • amino acids 35 to 109 (75 residues), 48.8 bits, E=3.9e-17

Best Hits

KEGG orthology group: K04092, chorismate mutase [EC: 5.4.99.5] (inferred from 97% identity to bll:BLJ_0255)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis II (2/4 steps found)
• L-tyrosine biosynthesis III (2/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (2/5 steps found)
• L-phenylalanine biosynthesis II (1/4 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (2/15 steps found)
• superpathway of chorismate metabolism (32/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.5

Protein Sequence (129 amino acids)

>BBR_RS11770 chorismate mutase (Bifidobacterium breve UCC2003)
MSETSSDWQKTTIDSAQAAAHPETAQAVARIKALRQTIDNIDSAAIALLAERFKATSQVG
VLKANAGFAPEDTKREDYQIERLHRIAMDAGLDPEIAEMYREFVVTEAKKRHKRIADAGG
DPGVLDVFA