Protein Info for BBR_RS11655 in Bifidobacterium breve UCC2003

Annotation: aquaporin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 8 to 30 (23 residues), see Phobius details amino acids 42 to 67 (26 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details PF00230: MIP" amino acids 7 to 238 (232 residues), 158.1 bits, see alignment E=1.5e-50 TIGR00861: MIP family channel proteins" amino acids 11 to 238 (228 residues), 184.1 bits, see alignment E=1.6e-58

Best Hits

Swiss-Prot: 46% identical to GLPF_STRR6: Glycerol uptake facilitator protein (glpF) from Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 97% identity to bll:BLJ_0240)

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>BBR_RS11655 aquaporin family protein (Bifidobacterium breve UCC2003)
MDYPLFTKLAAEFFGTAILMIFGNGSVANVELKNTKGHHAGWLNIAMGYGFGVMFPVLMF
GGVSGAHINPAMTIAQAVNGLFPWSDVLPYIVAQLLGALLGQFIVYLTYYPHYKETEDAD
AILGTFCTTDADNQKVNYFLNEMFGTLVLVFGALCCLSLAWGKQDYAAASIVVGFIVWGL
VTSMGGPTGPGLNPARDLMPRLLHAILPIPHKGSSRWGEAWIPVVAPIVGAIIGAWLYVF
FFAS