Protein Info for BBR_RS11515 in Bifidobacterium breve UCC2003

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 240 to 240 (1 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 366 to 390 (25 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 8 to 417 (410 residues), 410 bits, see alignment E=5.4e-127 PF00909: Ammonium_transp" amino acids 10 to 417 (408 residues), 376.7 bits, see alignment E=6e-117

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 99% identity to bll:BLJ_0220)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>BBR_RS11515 ammonium transporter (Bifidobacterium breve UCC2003)
MGAIDSGNTAWILTSASLVFLMTPGVAFFYGGMVRAKAVLNMLMLEAAALSVTMIIWTLW
GWSIAYAGSDIGGIFGDPASGFLLKDSMVAQDGVFTATGLNGNNYPVSVDVAFQVAFAMI
TVGLICGAIAERVKYSTWMIFVALWVTFDYAPMAHMVWNGGLLSADGAISKAIGAAAHDF
AGGTVVHINAAVAALIIVLIIGKRKGFGTQPFRPHNVPFVMLGAFLLWFGWFGFNAGSAF
AANGTAGYAWVSTSAATAAAMLSWGFTEKIRSGHYTAMGAASGMVAGLVAITPAADVVSP
LWAIVMGAIAGVLTCLACGLKFKFGYDDSLDVVGVHGVGGFTGTILVGFFGEGTGLLAGG
DWRQLVVQLVIALVAILYSAVITAIIAFALEKTIGWRVTEAQEVGGIDLADQGERAYDFA
GTASSVLKEVK