Protein Info for BBR_RS11510 in Bifidobacterium breve UCC2003

Annotation: signal recognition particle-docking protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details PF02881: SRP54_N" amino acids 135 to 199 (65 residues), 38.6 bits, see alignment E=1e-13 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 148 to 419 (272 residues), 327.4 bits, see alignment E=3.5e-102 PF00448: SRP54" amino acids 222 to 420 (199 residues), 250.6 bits, see alignment E=1e-78

Best Hits

Swiss-Prot: 85% identical to FTSY_BIFLO: Signal recognition particle receptor FtsY (ftsY) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 85% identity to blm:BLLJ_0197)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>BBR_RS11510 signal recognition particle-docking protein FtsY (Bifidobacterium breve UCC2003)
MDMNTVLAIAGVIVVAIVVIALSVWLGKSRKRDLDRAMGKTAPDDKRTRDAKAAADARLT
AEAEAAKESEKAGGAAAGTAATGKSTADAESVSPAAKPAVAESTAEPAKTETPESVGSRL
TRLKAKLAKSGNPFGKALFDILAKDNLSESDWEDVEDTLLLADVGAEASAQLVDDLKTDA
RITGKADPAEVRATLKDKLLDLVGRDTDRRLNVEKPGANKPGVIIMVGVNGTGKTTTAGK
LARLFVSEDKQVIMGAADTFRAAAADQLETWGTRVNVPVVRADKDGADPASVAFEASAKA
KEANADVLIIDTAGRLQNKANLMDELGKIRRVTEKNLPVDEVLLVLDATTGQNGMAQAKV
FAEAIGITGVVLSKLDGSAKGGIVISVQKELGVPVKLVGLGEGPDDLAPFDPEGFVDGIL
A