Protein Info for BBR_RS11480 in Bifidobacterium breve UCC2003

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 25 to 511 (487 residues), 641.1 bits, E=5.8e-197
• PF00479: G6PD_N
  • amino acids 29 to 212 (184 residues), 214.5 bits, E=2e-67
• PF02781: G6PD_C
  • amino acids 214 to 510 (297 residues), 395.8 bits, E=1.1e-122

Best Hits

Swiss-Prot: 70% identical to G6PD2_MYCTO: Glucose-6-phosphate 1-dehydrogenase 2 (zwf2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 99% identity to blm:BLLJ_0193)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• formaldehyde oxidation I (3/6 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (512 amino acids)

>BBR_RS11480 glucose-6-phosphate dehydrogenase (Bifidobacterium breve UCC2003)
MSESPNWSNPLRDSRDLRLPRIAGPCSLVIFGVTGDLAQKKLLPAVYDLANRGLLPPSFG
LTGFARRDWTQERFIEFVKTAVQAHCRTPFKESTWRNLAAGIRFVQGTFDDPEAFERLSA
TVQELDRDRGTRGNHAFYMSVPPRAFPQVAKQLAASGLSRSSEGAWRRVIIEKPFGHDLA
SAKELDSVVSEVFDPNSVFRIDHYLGKETVQNLLALRFANAMYEPIWNANYVDHVQITMA
EDIGIGGRAGYYDGIGAARDVIQNHLLQLMALTAMEEPVSFTAKDLTAEKTKVLSAVRLP
KDLAANTARGQYAKGWQGSHEVVGYLEEKGIDPSSTTETYAAIRLDIDTRRWAGVPFYLR
CGKRLGKRVTEIAVVFKRAPHLPFEQTAVRELGKNAIVIRVQPDEGVTMRFGAKVPGGST
MEVRDVNMDFSYGRSFTENSPEAYERLILDVLLGDPPLFPTTEEVNLSWEILDPIEQFWA
TLGQPQAYRAGTWGPAQADEMLERDGRHWRMP