Protein Info for BBR_RS11465 in Bifidobacterium breve UCC2003

Annotation: phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF03446: NAD_binding_2" amino acids 7 to 173 (167 residues), 165.4 bits, see alignment E=1.7e-52 TIGR00873: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 7 to 475 (469 residues), 668.2 bits, see alignment E=3.3e-205 PF02558: ApbA" amino acids 8 to 101 (94 residues), 27 bits, see alignment E=4.7e-10 PF00393: 6PGD" amino acids 181 to 474 (294 residues), 412.3 bits, see alignment E=1.8e-127

Best Hits

Swiss-Prot: 53% identical to 6PGD_SALTY: 6-phosphogluconate dehydrogenase, decarboxylating (gnd) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 98% identity to blf:BLIF_0171)

MetaCyc: 53% identical to 6-phosphogluconate dehydrogenase, decarboxylating (Escherichia coli K-12 substr. MG1655)
Phosphogluconate dehydrogenase (decarboxylating). [EC: 1.1.1.44]

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>BBR_RS11465 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) (Bifidobacterium breve UCC2003)
MAEATANIGVIGLAAMGSNLARNLAHHGNTVALFNRHYSRTEKLMNEHGTEGNFVPAETL
KEFAASLKRPRTAIIMVKAGAPTDATIEQLEKVFEPGDIIVDGGNSFFKDTIKREKEVRA
KGFHFVGCGVSGGEEGALNGPSLMPGGTAESWKTLGPILESIAAKVNGEPCVTHIGTDGA
GHFVKMVHNGIEYADMQVIGEAYDILRRGLGMDAEEIGDVFEEWNKGDLDSYLIEITAEI
LHHKDAETGKPFVDVVVDHAGMKGTGTWTVQTGLEFGSPVAAIGEAVFARALSSHGELRE
DAQKEGLAGPNKTIDLAGEDKAAFIEDVRKALFASKVVAYAQGLNEIQDGAKEYGWDINL
SEVARIWRGGCIIRAQFLLDRITEAFKGDNPPASLLFDPYFEKIIGESQDAWRRVIVRAV
EAGIPTPVFSSSLAYYDGLRSKRLPTALTQSQRDLFGAHTYGRVDKPGVFHTLWAEEGKP
EIEA