Protein Info for BBR_RS11460 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 78 to 105 (28 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 199 to 225 (27 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 268 to 293 (26 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details PF06541: ABC_trans_CmpB" amino acids 208 to 364 (157 residues), 140.7 bits, see alignment E=2.1e-45

Best Hits

KEGG orthology group: None (inferred from 90% identity to bll:BLJ_0209)

Predicted SEED Role

"FIG00425283: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>BBR_RS11460 hypothetical protein (Bifidobacterium breve UCC2003)
MIHVADGAKSAVVADLVADELDVVGLNPDARRLPILARIYGVLVLLDGLAVLPLVVLTCI
YSVREILNGRVHVDAMSLTFILSVVYALVLIVSAVCLIVFGVLLLRNHRRYAARWTYVLM
PLTLADGMLSLALTGLGFNLLLPIIQMIILIVISVTADPSLIEERRLQRALKRMDERDEY
ESAVAVGMLGRDQSGKGYIALDFFNIFWLFTIASVGGLIVETIYHFALYNGELQDRAGLL
WGPFSPIYGCGAVLVTVCLNRLWKANPFLIFCASAVIGGAFEYCTSWFMEVAFGITAWDY
TGRWLSIDGRTSGQFMFFWGLIGVVWVRWLLPRLLALINRIPWKVRYSLTAVCAVLMVID
IAFTLMALDCWYGRMAGQPQTSPVAMWFSERYSDAYMANRFQTMHLDPSKAGRM