Protein Info for BBR_RS11435 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 18 to 163 (146 residues), 127.7 bits, E=5.2e-41

Best Hits

Swiss-Prot: 43% identical to LOLD_FUSNN: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K02003, (no description) (inferred from 98% identity to blj:BLD_1250)

Predicted SEED Role

"Fe2+ ABC transporter, ATP-binding subunit"

Protein Sequence (265 amino acids)

>BBR_RS11435 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MLLELNHISKIYGDLHAVDDLNLTVPEGEWLAIVGSSGSGKTTLMNMIGCMDTPSKGSVK
LEGRKLEDLNATQLADVRKNLIGLVFQKFYLVPHLTAVENVMVAQYYHSVVDEKQAMEAL
EKVGLKDRAHHLPGQLSGGEQQRVCVARALINDPKLILADEPTGNLDEKNEKIVLDLFRK
LHEQGTTIIVVTHDALVASCAQREIMLNHGVLVGEKWNDEDARKVYEAVGGKPASTGAQV
EGAQNGETAIGFADPTKAAKTGGEE