Protein Info for BBR_RS11425 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 309 to 331 (23 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 241 (222 residues), 40.4 bits, see alignment E=4.1e-14 PF02687: FtsX" amino acids 313 to 427 (115 residues), 56.5 bits, see alignment E=2.7e-19

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 95% identity to bln:Blon_0199)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>BBR_RS11425 ABC transporter permease (Bifidobacterium breve UCC2003)
MFFLRMIARSFTRQLRRRLLIALTVCLSATVSVSMLGVVFDVGDKLNAELSTYGSNITVQ
PKADAVVSDLYNTEAGGVASTSDPTAFLKESDAAKIKTIFWAFNITNFAPQLNIHATVNG
TNASIVGTWFNKNLKLSTGETTVVGVEGMRSWWQLDGKWPKDDSDQGIIGKTLATELGVT
TGDTVTLNKTTASGKKNEQKITLTGVYDSGDEDNGSLYIASSIAQVLADLPDSVDKIEVK
ALTTPENDLARKAAQNPSVLSQDEWETWYCTAYPSSIAYQIEEVIPGAVAKQVRQVAALQ
GNVLQKTQAVMILMTVLSLIAATVAVANLMVASIGERSGELALLKALGATDAAVSRLMMA
ETATISLLGAIVGALLGSGVAQLIGQVVFGSGITMRPMVFVLVFVLLAVTVLLASASSIR
SILNLKPAEVLHGR