Protein Info for BBR_RS11420 in Bifidobacterium breve UCC2003

Annotation: DUF2318 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details PF10080: FtrD-like" amino acids 321 to 421 (101 residues), 108.4 bits, see alignment E=8.9e-36

Best Hits

KEGG orthology group: None (inferred from 94% identity to bln:Blon_0198)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>BBR_RS11420 DUF2318 domain-containing protein (Bifidobacterium breve UCC2003)
MLEQFVAVMPGTLAPALLVMCLSVMLAVGEGRDKPASAHWRLIGLIVGLIAAIVFASLRA
SAVINQRTFVNYPVLWCAIIADILAIIVVVFARRITTNWQRHKAIMHIANAIAAIDIALT
LFYALPDVILQLTIWVEPGDPIFTSDMLLRALGFALGLAMSIIVAAIFRTLRSTAVRASF
TAAVLAVMVILFIQHLTGVMQILQAHGFPMGHTAFVALAWSINHNSWMIMAQAFVFLIPA
VASVVAGFRMPLTGANEAIGRKHKAFRRRAVASAVWSLVAMIGVTLTLTVGVAATQQTIT
LSPPEAYSLKDGVATIPFSQVEDGHLHRFEYKAKDGTVMRFIIIKKNGGAYGIGLDACEN
CGDAGYYEKDGKIICKKCEVAINLATIGFKGGCNPIPFPYKTGNGKITIQTTDLDALSAH
FQ