Protein Info for BBR_RS11415 in Bifidobacterium breve UCC2003

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF10634: Iron_transport" amino acids 62 to 227 (166 residues), 179.9 bits, see alignment E=1.8e-57

Best Hits

KEGG orthology group: K07230, (no description) (inferred from 93% identity to bln:Blon_0197)

Predicted SEED Role

"Periplasmic protein p19 involved in high-affinity Fe2+ transport" in subsystem Campylobacter Iron Metabolism or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>BBR_RS11415 amino acid ABC transporter substrate-binding protein (Bifidobacterium breve UCC2003)
MMKNKKLAALLGVLLAGSMAVSMAACGSSNNASDTKASTSSSDTAKKDDSAKADAPSDTA
GFEEVPVGPSGTAEEQDKPAGPLTVGAVYFQPIDMEPASSGLKAADASFHLEADIHASQE
GTDYGYGKGDFVPDLTVNYTIIDKSTGKEVEGGKATSGTFMQMNASDGPHYGANVKLDKA
GTYQLKLSIESPASKGWMLHVDPETGVKNHQFWTEPIEVTFDNWDYTPRQW