Protein Info for BBR_RS11245 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 291 to 318 (28 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 358 to 375 (18 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 445 to 466 (22 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 347 (307 residues), 53.3 bits, see alignment E=2.1e-18 amino acids 304 to 468 (165 residues), 46.3 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to blm:BLLJ_0160)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>BBR_RS11245 MFS transporter (Bifidobacterium breve UCC2003)
MSNNSSNSNTNTVMAGIKEVGHKVFGGYAELLRIPHTARYSIGSVIACMPFPMVGMTITI
SVQHYYGNYSLAGMLTAIQAIALAISTPLLGKLTDKFGQRQVSIPTIIVWIVAAIALTTA
ITNRAPEWVLYCLTPFLAAIPPWGAMSRARWTKILKGDQERTNRALSLCGVLDECMWVIG
NPLASTLAVISGLLAFSFTGMCVVVGALMFLTELTTEPPSQTALARAEGISRKEYREREA
ARAEALKAETAAEETRRRLEREGVTDQAVIDKEIAQAVADARSGKKASIWGPGLIAVCVT
WFGLGAFQSATGISIIAFATESNMKQYTGFVFACFSISSLMGALVYGAKNWSIALWKRFY
FCLAVVNIGISTFLFAKHLWVIMIIYLIIGVCQAPTWINGNQLMLHLVPPSRLTEGMAWM
GAMNSIGSSAGSAIAGQFIDRMGSHGGFMVVTTLALASLVIALIGFKQIKGSTEQPTLTE
VSV