Protein Info for BBR_RS11230 in Bifidobacterium breve UCC2003

Annotation: formate--tetrahydrofolate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01268: FTHFS
  • amino acids 30 to 306 (277 residues), 214.2 bits, E=1.3e-67

Best Hits

Swiss-Prot: 96% identical to FTHS_BIFLO: Formate--tetrahydrofolate ligase (fhs) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01938, formate--tetrahydrofolate ligase [EC: 6.3.4.3] (inferred from 95% identity to bln:Blon_0181)

Predicted SEED Role

"Formate--tetrahydrofolate ligase (EC 6.3.4.3)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.4.3)

MetaCyc Pathways

• formate assimilation into 5,10-methylenetetrahydrofolate (3/3 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
• folate polyglutamylation (4/5 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (9/12 steps found)
• formaldehyde oxidation VII (THF pathway) (3/4 steps found)
• folate transformations III (E. coli) (4/9 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)
• folate transformations II (plants) (5/11 steps found)
• L-histidine degradation III (1/6 steps found)
• reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
• folate transformations I (4/13 steps found)
• purine nucleobases degradation I (anaerobic) (3/15 steps found)
• purine nucleobases degradation II (anaerobic) (8/24 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (16/56 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.3

Protein Sequence (505 amino acids)

>BBR_RS11230 formate--tetrahydrofolate ligase (Bifidobacterium breve UCC2003)
MTTIEDFTSQYGLVQKIDAFGYMKYLAENPDAPRKHGKVILVTADTPLKASRGEGKTTTT
IALIDALNKRGIDAAAVLRQPSMGITAAGSKGGASGGGKASLTHPELIDWGLCGEMGAIE
AAQNLLVSFAEKAVDEGKLDTILVPRVSEVPSRSLRSIAVDYGKGNVAEKTVLTPTSELM
QIVVLSRSMDEIAERVSKMIAGTKDGQAVTFGEFVDLWRITGILADAVKPAKTETVNGSP
VYVHGGPFANVSIGIPTLVSVEMACALHDVVVVEAGYGTDAGAQKWLDIACREFGAQWPS
AAIVVTRASTWRDDPELAWRYPFHVQRLENLDIPTFPLINLWEGEDDQVPSLKATADELG
FRTPIIGNLFRDGGEALVPQLDGFVDALENGSMPAEPHSHKGMALTENAKWVAENAYGVP
ADRVIYKPGFTESAAEAMELCQSAGISLYDLAFVAVKSPATMTDNDRAPEAERTVTLKKV
EVHAGAGLVHVNLTTSLTTPMPKIV