Protein Info for BBR_RS11210 in Bifidobacterium breve UCC2003

Annotation: phosphoenolpyruvate--protein phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 TIGR01417: phosphoenolpyruvate-protein phosphotransferase" amino acids 3 to 542 (540 residues), 415.4 bits, see alignment E=1.7e-128 PF05524: PEP-utilisers_N" amino acids 4 to 128 (125 residues), 66.4 bits, see alignment E=4.1e-22 PF00391: PEP-utilizers" amino acids 156 to 226 (71 residues), 75 bits, see alignment E=4.7e-25 PF02896: PEP-utilizers_C" amino acids 249 to 526 (278 residues), 270.8 bits, see alignment E=2e-84

Best Hits

Swiss-Prot: 50% identical to PT1_STRCO: Phosphoenolpyruvate-protein phosphotransferase (ptsI) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K08483, phosphotransferase system, enzyme I, PtsI [EC: 2.7.3.9] (inferred from 98% identity to bln:Blon_0178)

Predicted SEED Role

"Phosphoenolpyruvate-protein phosphotransferase of PTS system (EC 2.7.3.9)" in subsystem Fructose and Mannose Inducible PTS or Fructose utilization or Mannitol Utilization (EC 2.7.3.9)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (549 amino acids)

>BBR_RS11210 phosphoenolpyruvate--protein phosphotransferase (Bifidobacterium breve UCC2003)
MEIKGVGIGRGVAVGSVIRMAAPLPEPSDAPRADTVPAQGEIDRVTKSLAVVNADLSRRA
EEAANGDEGAKKAAPILQAISMFASDPSLAASITSLINGGKTAERAVLEGFAAVEDMFRA
IGGYQAERAADLHDVGQRVIADLMGVPAPGIPESETPFVLVAEDLSPADTAAIDLNKVLA
IVTSQGGPTSHTAILARARGIVAVVSAAEAENLTNGEQVIVNAAKGVVIANPTAAEIEDA
EAAKAHAAKAKELRGKPGATKDGHHIPLLANVGKPADADPALEYGAEGVGLFRSEFLFIG
NSEPPSVEEQTKAYAELLSRFPGKKVVIRMLDAGADKPLPFLTPEDEPNPALGLRGLRTL
KAHMNVLEGQLKALAAADAQTEADLWVMAPMVADEHEADYFVKLGKSFGLKKVGVMAEVP
SIALVADKVAEVADFVSIGTNDLTQYTLAADRTLGSVANYQTAWHPSVLRAIKLIADAGN
AHGMPVGVCGEAAADPDLAVVLAGIGVNSLSMTPVALDDVRAELANWTLEEAQEKAAKAL
NGDFYTPAE