Protein Info for BBR_RS11180 in Bifidobacterium breve UCC2003

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 101 to 120 (20 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 342 to 369 (28 residues), see Phobius details PF01569: PAP2" amino acids 203 to 291 (89 residues), 41.2 bits, see alignment E=7.2e-15

Best Hits

KEGG orthology group: None (inferred from 74% identity to bll:BLJ_0154)

Predicted SEED Role

"phosphoesterase, PA-phosphatase related"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>BBR_RS11180 phosphatase PAP2 family protein (Bifidobacterium breve UCC2003)
MNDAQNPVIRDPHAPASMVGGASDARSAADNASDPFAALGSGSAAAGASSNVIDPLAGLG
SPARGPSLGLDDLDPLDSGEVDRGLAKLDPLAVRPRISSRVLCAVFGLLLIAAGFGIWWV
CVFTEDGQSYDELVWKNLVTNVPDAVGGLMSLVAQSWLVIAISCLFAVIGVVSALVHRRW
WLVGQIVVFAVVCLAVTRIKGVLPRPFIINTDSPAANSAPSGHTMLAAACAVILLLAVPR
VARALAGIIGVIWSWAVGVSVIYGQWHRPSDVAMSILLVAGLALIVLAFTRTSGMDEPGS
RVSSVSVQIVSSVLITGGLLLLAYSAYVIWQVVPGLNISASWAVSGSIVSAIVGVAGVAA
LTFGLLLALRHITAAPLSRLGLIGAPPAPPQR