Protein Info for BBR_RS11070 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF00005: ABC_tran" amino acids 30 to 172 (143 residues), 133.3 bits, see alignment E=1.4e-42 PF08402: TOBE_2" amino acids 287 to 359 (73 residues), 30.3 bits, see alignment E=5.5e-11

Best Hits

Swiss-Prot: 44% identical to POTA_PASMU: Spermidine/putrescine import ATP-binding protein PotA (potA) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 97% identity to bln:Blon_0656)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>BBR_RS11070 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MTTVAVGSLPQGTSVTLRNVTKSFGTTKVLNGLDLNIHSGELVALLGPSGCGKSTLLRII
AGFEAADQGSVLLDDVDVSGVPTNRRDIGLVFQAYSLFPHLNAVENVMYGLSIRHVAKTE
AKSRAVELLASVGLADYADRYPAQLSGGQQQRVALARALATKPRVLLLDEPLSALDAKVR
VQLRDEIRALQLETHTTTIMVTHDQEEALVMADRIAVMYNGRFEQVGTPAEIYHSPATAF
VAGFVGSMNVLPGVLSTDGTAQTIGCRVPVRAATSAATLDPGPVDVFVRPEELRLQISND
DLNNRDAVLGIVTSTVLRGAFTSVMVAMGDGLHLRVDLPSKDAQLFAPGCSVMVRIADEP
MLCTARRVECVA