Protein Info for BBR_RS11055 in Bifidobacterium breve UCC2003

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13416: SBP_bac_8" amino acids 70 to 320 (251 residues), 60.8 bits, see alignment E=3.8e-20 PF01547: SBP_bac_1" amino acids 70 to 308 (239 residues), 43 bits, see alignment E=1.2e-14 PF13531: SBP_bac_11" amino acids 71 to 315 (245 residues), 56.9 bits, see alignment E=5.5e-19 PF13343: SBP_bac_6" amino acids 111 to 348 (238 residues), 92 bits, see alignment E=8.9e-30

Best Hits

KEGG orthology group: None (inferred from 54% identity to mph:MLP_18510)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>BBR_RS11055 ABC transporter substrate-binding protein (Bifidobacterium breve UCC2003)
MTNIWRKGVTGLLVALLGITMSACGTSSAQSESDTKVGSNLEEITKLAKQEGKLELIGYP
ETWAGYGDSFKAFTKKYGIKIHVSSPDASSAEEIQSIQTLKGQPSQPDVPDLGYSFTDPA
KQKNLLSSYTPSVANELPANLKDPDGKWVGAYYGVLSIGVDESKVPAVTSWKDLLKPVYK
GKIYIGNPREGASQLAAVASAALANGGSLDNIQPGIDFFSKLAKDGYLAKASGTAQALTT
GQAAVVLDWNYNFNGIRDEVEKAGVKLTVNVPTDGVFGNYYAQSALVDAPHPNAARLWLE
WLLSDDGANIYAEHGAIPARFQEMKKVGTLTKEAEAGLPDADTLKRISFPNIEQGNKMSQ
LVVKNWGSQVANFE