Protein Info for BBR_RS11025 in Bifidobacterium breve UCC2003

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR00978: aspartate-semialdehyde dehydrogenase" amino acids 5 to 355 (351 residues), 342.6 bits, see alignment E=1.2e-106 PF01118: Semialdhyde_dh" amino acids 6 to 136 (131 residues), 107.7 bits, see alignment E=5.4e-35 PF02774: Semialdhyde_dhC" amino acids 172 to 341 (170 residues), 84.8 bits, see alignment E=8.8e-28

Best Hits

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 98% identity to bln:Blon_0166)

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>BBR_RS11025 aspartate-semialdehyde dehydrogenase (Bifidobacterium breve UCC2003)
MPEKIKVGILGATGMVGQRFITLLENHPWFEVVTLAASAHSAGKTYEEAVGSRWKMETPM
PEYAKHMVVADGDDAESVAANVDFMFSAVNMPKDEIRAIEERYAKTETPVVSNNSAHRWT
PDVPMVVPEINPEHFAVIEHQRKRLGTTRGFIAVKPNCSIQAYTPALAAWKEFEPREVVV
STYQAISGAGKTFQDWPEMVGNIIPFISGEEAKSEKEPLKVFGHVDADKGKIVPFDGDLK
ITSQCIRVPVLNGHTATVFLNFGKKATKEELIDRLVNYTSKASELGLPHAPKHFIQYLTE
DDRPQVKLDVDYEGGMGVSIGRLREDSIFDWKFVGLAHNTLRGAAGGALECAEMLKALGY
ITKK