Protein Info for BBR_RS10970 in Bifidobacterium breve UCC2003

Annotation: pilus assembly protein TadE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details transmembrane" amino acids 14 to 37 (24 residues), see Phobius details TIGR03816: helicase/secretion neighborhood TadE-like protein" amino acids 8 to 115 (108 residues), 82 bits, see alignment E=1.7e-27

Best Hits

KEGG orthology group: None (inferred from 60% identity to bll:BLJ_0141)

Predicted SEED Role

"FIG00423914: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>BBR_RS10970 pilus assembly protein TadE (Bifidobacterium breve UCC2003)
MPRMSRLEEGSGTMAGVMLVMLVGVALSATACIGNLVVCQNRARSLADLIAFDAAYAAWH
GWADDPCAFAGQLAVSNSVALPDCMVQSDDVQVTVAVDTAVPLTPRVQRTALAGPAECDK
GGASE