Protein Info for BBR_RS10950 in Bifidobacterium breve UCC2003

Annotation: pilus biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00437: T2SSE" amino acids 19 to 274 (256 residues), 149.7 bits, see alignment E=4.5e-48

Best Hits

KEGG orthology group: K02283, pilus assembly protein CpaF (inferred from 73% identity to blj:BLD_1297)

Predicted SEED Role

"Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>BBR_RS10950 pilus biosynthesis protein (Bifidobacterium breve UCC2003)
MTALHRAGMFFGLLDELASDDRVTDIAVTCEGRVWADRGSGMREHILQVPFRSPQVVRDY
AVQLCAQLGRRLDDACPIADASNMHGVRVHAVIAPLVPQGASISIRFPGSEVASLQRLAQ
LGMFPAGWISVLSGLVSKRAAVLITGGTGVGKTTLAKALLAQCDANDRIVTVEEVRELVD
FGHGNHVSMAAREANVEGEGAVGLPDLVKATLRMRPDRVVLGECRGEEIVDLLRAFNSGH
RGGMTTLHANSVAQVPQRLIALGLLAGVAPRALAMLAEGAFDAVLHLERVDGRRHIAQIG
TLHASYGELQGVPLVAWDGSAEPRYSPQWRDFAALWGCS