Protein Info for BBR_RS10940 in Bifidobacterium breve UCC2003

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 49 to 180 (132 residues), 75.5 bits, see alignment E=2.5e-25

Best Hits

KEGG orthology group: K03975, membrane-associated protein (inferred from 95% identity to blj:BLD_1299)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>BBR_RS10940 DedA family protein (Bifidobacterium breve UCC2003)
MGFVNFILELLKDPRAAIAGWIAMGVAPTLGFIFLIVFIETGVVFFPFLPGDSLLFAAGV
FAAPDAATGKAALPLFWLLPVVWCAPIVGDQCNYFIGHFFGRRIIQSGKVKALTPERLAK
TEHMIEKWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPFSVAGGLCWSTLFTLLGY
FFGNIPAVQDHFELVIVLILLVSLAPTIIGLLKAKFGKKKPESVADSQLDTMESGIENLN
K