Protein Info for BBR_RS10880 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 284 (175 residues), 52.3 bits, see alignment E=3e-18

Best Hits

KEGG orthology group: K10110, maltose/maltodextrin transport system permease protein (inferred from 79% identity to mcu:HMPREF0573_10265)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>BBR_RS10880 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MKQPESHGLMHDTKKRRILGDVLSYLFLGVMAIIWLIPIVWVFAESFNKNTAPYTKTFFP
TEFSLDNYITLFTDRSVLNFPKMFMNTFIVACFVCLISVVFVLSVAYCMSRMRFRTRKTF
MNVVLVLGMFPGIMAVSAIYFILKAVGLTSEGMTTIALILVYSAGTGAGFYVMKGYMDTI
PTSLDEAALLDGCTRLQVFTKIIIPICKPMIVYQAIIGFLTPWLDFVMAKVICRTQSNYT
VALGLWLMLQKEYIQNWYARFAAAAVVISIPIAILFIVMQRFYQESMSGSVKG