Protein Info for BBR_RS10875 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 60 to 80 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 169 to 194 (26 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 432 to 454 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 249 to 454 (206 residues), 73.6 bits, see alignment E=8.9e-25

Best Hits

KEGG orthology group: K10109, maltose/maltodextrin transport system permease protein (inferred from 81% identity to bde:BDP_2197)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>BBR_RS10875 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MTAAALSPREMKRRRKMGADYVAPSPYSVGNALTKGDVLTKLSAVVFGLGNIVRKQYVKG
VALLALEIAFFVFLFTNGITCLSKLPSLGDQKQGKVLVDGFWEYTQGDNSVVILLYGVCT
VVLCLLFIYLWTVSLKSAYKAECLAREQGKAPSLGNDLRELTNAKVHRLLMFLPTLGILV
FTVLPLIFMISMAFTSYDRNHLVLFDWVGFDNFAKVFSNSGGTVNARLFLQVTIWTLVWA
FFATFLNFFIGMFFAMVINRKTTRFKGFWRACFSMSIAVPQFVSLLVMRTMLQPTGAINR
LLMEWGWIDQALPFFTDATWARVTVIVINLWVGIPYTIMQVTGILQNIPADQYEAAKIDG
ANWWQIFTKITMPYIIFVLTPYLITTFTGNVNNFNVIYLLSGGNPVPVGDSAGKTDLLIT
WLYKLTVDKNDYNLGAVIGIMTFIVLAVVSLITYRNSGSYKNEETFR