Protein Info for BBR_RS10855 in Bifidobacterium breve UCC2003

Annotation: class C sortase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details TIGR01076: sortase" amino acids 131 to 259 (129 residues), 165.4 bits, see alignment E=3.1e-53 PF04203: Sortase" amino acids 133 to 257 (125 residues), 100.7 bits, see alignment E=2.6e-33

Best Hits

KEGG orthology group: K07284, sortase A (inferred from 57% identity to bde:BDP_0536)

Predicted SEED Role

"Sortase A, LPXTG specific" in subsystem Heme, hemin uptake and utilization systems in GramPositives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>BBR_RS10855 class C sortase (Bifidobacterium breve UCC2003)
MRSSTGAKQSGTRTQSRVFTVLSVLFLLIGFAIITTPFVMRAISEYQQNATVQQTQREVD
GWPYPQAENQLKTARDYNKKLVAGGQAAIGEVKDPFASNAGQSTTSGADDSMAAKDQEYQ
SLLDAGQGVMGSIRIPKIDVNLPIYHGTSEDALAVGAGHLYGTSLPVGGKSTHSVITGHR
GLPNSLLFTRLDEMKKGDSFYIEVMGKTLGYKVDRITVIKPDDSSKLRITKGEDRVTLMT
CTPYGVNSHRLLVSGVRAEIPEEVPDPDDVHGINTTWLALGAIVLLAVLLAFIVILMRRK
QKRDREFAGLARHAARPTK