Protein Info for BBR_RS10820 in Bifidobacterium breve UCC2003

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 98 (17 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 249 to 257 (9 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 129 to 302 (174 residues), 50.2 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K10242, cellobiose transport system permease protein (inferred from 78% identity to bde:BDP_0139)

Predicted SEED Role

"putative sugar transport integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>BBR_RS10820 carbohydrate ABC transporter permease (Bifidobacterium breve UCC2003)
MVDLTNESDKREVGVPALEQVYGKSVARAAKRQRNARLGMTSEGRKPGWGSYAILIVTLL
IFVFPLYYALSIASQNTPSNQYGVRALIPGTALLHNLSRALGELKFWQALGGTVTVAVVV
SVSTVFFSTLAGYSFAKLHFRGRSVLLTAVVATMTIPQQLTVVPLYIMANKAGLYGNLLA
VIIPGLVSAFGVFWMTQYITDALPYELIEAARVDGCSMFRTFISVGVPAARPAASMLFLF
TFIGQWTNYFWPMLVLGANKSYMLTTAAAALKGAYFTDYTIVMSGVILTTAPLLLLFFVA
GKQLVAGIMAGAVKG