Protein Info for BBR_RS10810 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13416: SBP_bac_8" amino acids 63 to 367 (305 residues), 102.7 bits, see alignment E=3.3e-33 PF01547: SBP_bac_1" amino acids 65 to 342 (278 residues), 79 bits, see alignment E=6.4e-26

Best Hits

KEGG orthology group: K10240, cellobiose transport system substrate-binding protein (inferred from 65% identity to bde:BDP_0137)

Predicted SEED Role

"putative sugar binding secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>BBR_RS10810 hypothetical protein (Bifidobacterium breve UCC2003)
MKRSKAMFSAVLAVATVVSLAACGTANNSGNATTKDGKTIIKIQTFNNFGYGKPTNERPS
ADLWSKYEKLHPNIKIEETIASGSDEARSAFNTAISSGSDAYDIYAADIAWMPSVLAISD
SFMDLSSYLKKNDWLDWKVEGGKANGKIIGAGNDIGPTAVCYRSDLFQKAGLPTDRTEVA
KMLGGDSATWDQYFKVGREYTQKTGLPWYDAMGGLWGTMKSQMKESYVKKDGTIVATTDK
MKKNFETLTATTDMSAHLTQWSDDWNAQFKSDKGFATIMCPAWLVNNIKGNAGSDFKGWD
IADVTPGGGSNQGGSWLVVPESSKVKEEAAKLVAWLTAPEQQVATFKAASNYPSSPTAMA
NDTVSNKVDTFLNNAPTGKIFADRAKAVKVVPYMGAQYFDIDSKFGNALDRVDVNKEQTP
SQAWKQYVDDVKSLS